Return to main results Retrieve Phyre Job Id

Job DescriptionP08204
Confidence81.96%DateThu Jan 5 11:00:58 GMT 2012
Rank143Aligned Residues63
% Identity19%Templatec3bf1C_
PDB info PDB header:transferaseChain: C: PDB Molecule:type iii pantothenate kinase; PDBTitle: type iii pantothenate kinase from thermotoga maritima2 complexed with pantothenate and adp
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40.........50.........60.........70.........
Predicted Secondary structure 

.






























Query SS confidence 

.












































































Query Sequence  MA. IAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIESMEAALKTVLAELSVEQRAA
Query Conservation 
 .  








 
  
 
   
 
                        
 

          
              
Alig confidence 

.
















..

















..................















....

Template Conservation 
  
 
 





 

    ..            
     .................. 
     
        ....  
Template Sequence  MDPMYLLVDVGNTHSVFSIT. . EDGKTFRRWRLSTGVFQT. . . . . . . . . . . . . . . . . . EDELFSHLHPLLGDAM. . . . RE
Template Known Secondary structure 



SS..SSSSS


TT

..................GGGG....GT
Template Predicted Secondary structure 








..








..................


....

Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions