Return to main results Retrieve Phyre Job Id

Job DescriptionP08204
Confidence90.42%DateThu Jan 5 11:00:58 GMT 2012
Rank122Aligned Residues61
% Identity36%Templatec2oceA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein pa5201; PDBTitle: crystal structure of tex family protein pa5201 from2 pseudomonas aeruginosa
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10 .........20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 

.





























Query SS confidence 








.





































































Query Sequence  AIAIGLDFG. SDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAV
Query Conservation     





.


 
  
 
   
 
                        
 

          
              
Alig confidence 








.









.










.







................
















....

Template Conservation    






   
 
 
 

.  
 


   
.        ................       
   
    
.... 
Template Sequence  RATLGLDPGLRTGVKVAVVD. ATGKLLDTATV. YPHAPKNQ. . . . . . . . . . . . . . . . WDQTLAVLAALCAKHQV. . . . EL
Template Known Secondary structure  S


STT

.TTS
.

STTT

................TT
....
Template Predicted Secondary structure 







.



.



................


....
Template SS confidence 















































































   329330.........340........ .350......... 360....... ..370.........380.... ..
 
   81...
Predicted Secondary structure 
Query SS confidence 



Query Sequence  VGIG
Query Conservation   

 
Alig confidence 



Template Conservation 



Template Sequence  IAIG
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   387..390
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions