Return to main results Retrieve Phyre Job Id

Job DescriptionP08204
Confidence96.99%DateThu Jan 5 11:00:58 GMT 2012
Rank72Aligned Residues59
% Identity25%Templatec2gupA_
PDB info PDB header:transferaseChain: A: PDB Molecule:rok family protein; PDBTitle: structural genomics, the crystal structure of a rok family protein2 from streptococcus pneumoniae tigr4 in complex with sucrose
Resolution2.01 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.........70.........80...
Predicted Secondary structure 






























Query SS confidence 















































































Query Sequence  AIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGI
Query Conservation   








 
  
 
   
 
                        
 

          
              
 

Alig confidence 
















.















....................













......





Template Conservation 








     
 
.  
 

          ....................       
   
  ......  
  
Template Sequence  IATIDIGGTGIKFASLT. PDGKILDKTSISTPEN. . . . . . . . . . . . . . . . . . . . LEDLLAWLDQRLSE. . . . . . QDYSGI
Template Known Secondary structure  TT
.TT




SS....................TT......S

S
Template Predicted Secondary structure 




.







..........................



Template SS confidence 















































































   3......10......... 20.........30..... ....40......... 50.....
 
   84.....
Predicted Secondary structure 



Query SS confidence 





Query Sequence  GVDSTG
Query Conservation   

   
Alig confidence 





Template Conservation 


  
Template Sequence  AXSVPG
Template Known Secondary structure  SS
Template Predicted Secondary structure 


Template SS confidence 





   56...60.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions