Return to main results Retrieve Phyre Job Id

Job DescriptionP08204
Confidence97.68%DateThu Jan 5 11:00:58 GMT 2012
Rank47Aligned Residues65
% Identity23%Templatec2aa4B_
PDB info PDB header:transferaseChain: B: PDB Molecule:putative n-acetylmannosamine kinase; PDBTitle: crystal structure of escherichia coli putative n-2 acetylmannosamine kinase, new york structural genomics3 consortium
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  MAIAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAV
Query Conservation 
   








 
  
 
   
 
                        
 

          
              
Alig confidence 

.
















.















..............
















........



Template Conservation 
 .




 


     
 
.  
 

          ..............         
   
   ........    
Template Sequence  MT. TLAIDIGGTKLAAALIG. ADGQIRDRRELPTPAS. . . . . . . . . . . . . . QTPEALRDALSALVSPL. . . . . . . . QAHA
Template Known Secondary structure 

.
SS
.TT



SS..............

........TT
Template Predicted Secondary structure 
.



.







..............

........
Template SS confidence 















































































   1. .......10......... 20.........30..... ....40.........50.. ....
 
   81........
Predicted Secondary structure 



Query SS confidence 








Query Sequence  VGIGVDSTG
Query Conservation   

 

   
Alig confidence 








Template Conservation    
     
Template Sequence  QRVAIASTG
Template Known Secondary structure  SSS
Template Predicted Secondary structure 


Template SS confidence 








   57..60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions