Return to main results Retrieve Phyre Job Id

Job DescriptionP29745
Confidence21.33%DateThu Jan 5 11:45:41 GMT 2012
Rank98Aligned Residues32
% Identity16%Templatec2jmkA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:hypothetical protein ta0956; PDBTitle: solution structure of ta0956
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40...
Predicted Secondary structure 
















Query SS confidence 










































Query Sequence  MDKLLERFLNYVSLDTQSKAGVRQVPSTEGQWKLLHLLKEQLE
Query Conservation 
    
 
  

 
 
 
            
      
   
 
Alig confidence 


















...........












Template Conservation 



 


 

 

     ........... 


 







Template Sequence  MDRFLESFSELYDIIDEND. . . . . . . . . . . TDVMMDFISRFAR
Template Known Secondary structure  GGGTTS

...........SS

Template Predicted Secondary structure 



...........
Template SS confidence 










































   23......30.........40. ........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions