Return to main results Retrieve Phyre Job Id

Job DescriptionP75937
Confidence2.27%DateThu Jan 5 12:16:11 GMT 2012
Rank84Aligned Residues25
% Identity20%Templatec3m6zA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:topoisomerase v; PDBTitle: crystal structure of an n-terminal 44 kda fragment of topoisomerase v2 in the presence of guanidium hydrochloride
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   364.....370.... .....380........
Predicted Secondary structure 


..........
Query SS confidence 










. . . . . . . . . .













Query Sequence  NVDLSKELVNM. . . . . . . . . . IVAQRNYQSNAQTI
Query Conservation 






  

..........
  



 





Alig confidence 










..........













Template Conservation 


































Template Sequence  GVNFDERVQRLSTGGSPARYAIVYRRGWRAIAKAL
Template Known Secondary structure  TSTT


TSTTT
Template Predicted Secondary structure 









Template SS confidence 


































   84.....90.........100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions