Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence88.74%DateThu Jan 5 11:42:17 GMT 2012
Rank221Aligned Residues42
% Identity24%Templated1yq2a5
SCOP infoTIM beta/alpha-barrel (Trans)glycosidases beta-glycanases
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   231........240.........250.........260.........270.........280.........290.........300.........310
Predicted Secondary structure 















































Query SS confidence 















































































Query Sequence  LTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFD
Query Conservation 
  





 


 






                
    


   

  


 


 



 

  

 







Alig confidence 

















........................





...............
















Template Conservation     

   
  
 
 

 ........................ 
    ...............  
   

  

 
  
Template Sequence  AREDLALMKRFNVNAIRT. . . . . . . . . . . . . . . . . . . . . . . . SHYPPH. . . . . . . . . . . . . . . PRLLDLADEMGFWVILE
Template Known Secondary structure  TT

........................TTS


...............T
Template Predicted Secondary structure 



........................




...............


Template SS confidence 















































































   350.........360....... ..370... ......380.........390
 
   311
Predicted Secondary structure 
Query SS confidence 
Query Sequence  V
Query Conservation   
Alig confidence 
Template Conservation   
Template Sequence  C
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   391
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions