Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence87.13%DateThu Jan 5 11:42:17 GMT 2012
Rank232Aligned Residues44
% Identity11%Templated1jz8a5
SCOP infoTIM beta/alpha-barrel (Trans)glycosidases beta-glycanases
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   229230.........240.........250.........260.........270.........280.........290.........300........
Predicted Secondary structure 















































Query SS confidence 















































































Query Sequence  RGLTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRIL
Query Conservation   

  





 


 






                
    


   

  


 


 



 

  

 





Alig confidence 



















........................





...............














Template Conservation 
    

 


  
 
 

 ........................ 
 
  ...............  

   

 



 
Template Sequence  QTMVQDILLMKQNNFNAVRC. . . . . . . . . . . . . . . . . . . . . . . . SHYPNH. . . . . . . . . . . . . . . PLWYTLCDRYGLYVV
Template Known Secondary structure  TT


........................TTS


...............T
Template Predicted Secondary structure 



........................




...............


Template SS confidence 















































































   370.........380......... 390..... ....400.........410
 
   309310.
Predicted Secondary structure 
Query SS confidence 


Query Sequence  FDV
Query Conservation 

 
Alig confidence 


Template Conservation   
 
Template Sequence  DEA
Template Known Secondary structure 
Template Predicted Secondary structure 

Template SS confidence 


   411..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions