Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence96.04%DateThu Jan 5 11:42:17 GMT 2012
Rank155Aligned Residues53
% Identity25%Templatec3u7vA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-galactosidase; PDBTitle: the structure of a putative beta-galactosidase from caulobacter2 crescentus cb15.
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   231........240.........250.........260.........270.........280.........290.........300.........
Predicted Secondary structure 















































Query SS confidence 














































































Query Sequence  LTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILF
Query Conservation 
  





 


 






                
    


   

  


 


 



 

  

 






Alig confidence 















.













...............




..........

















Template Conservation 
      


 
 


.   
 
   

 

............... 



.......... 

  
  
   

 


Template Sequence  XAKVWPAIEKVGANTV. QVPIAWEQIEPVEG. . . . . . . . . . . . . . . QFDFS. . . . . . . . . . YLDLLLEQARERKVRLVL
Template Known Secondary structure  T
S.
SBTT...............B


..........TT
Template Predicted Secondary structure 



.





...............
..........


Template SS confidence 














































































   72.......80....... ..90.........100. ..... ...110.........120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions