Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence95.00%DateThu Jan 5 11:42:17 GMT 2012
Rank161Aligned Residues54
% Identity19%Templatec3pzvB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:endoglucanase; PDBTitle: c2 crystal form of the endo-1,4-beta-glucanase from bacillus subtilis2 168
Resolution2.87 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   232...... .240.........250.........260.........270.........280.........290.........300.........310
Predicted Secondary structure  .















































Query SS confidence 






.







































































Query Sequence  TNKLDYL. QQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFD
Query Conservation    




.
 


 






                
    


   

  


 


 



 

  

 







Alig confidence 






.










.......................









.



..




















Template Conservation             
 
 


 .......................          .    ..   

  
  
   

 



Template Sequence  KDSLKWLRDDWGITVFRAA. . . . . . . . . . . . . . . . . . . . . . . MYTADGGYID. NPSV. . KNKVKEAVEAAKELGIYVIID
Template Known Secondary structure  TS

S.......................SSTTSTTT.
GGG..T
Template Predicted Secondary structure 



.......................









.
..


Template SS confidence 















































































   76...80.........90.... .....100.... .... .110.........120.........
 
   311
Predicted Secondary structure 
Query SS confidence 
Query Sequence  V
Query Conservation   
Alig confidence 
Template Conservation   
Template Sequence  W
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions