Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence67.42%DateThu Jan 5 11:42:17 GMT 2012
Rank336Aligned Residues44
% Identity14%Templatec3m6yA_
PDB info PDB header:lyaseChain: A: PDB Molecule:4-hydroxy-2-oxoglutarate aldolase; PDBTitle: structure of 4-hydroxy-2-oxoglutarate aldolase from bacillus cereus at2 1.45 a resolution.
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   231........240.........250.........260.........270.........280.........290.........300.......
Predicted Secondary structure 















































Query SS confidence 












































































Query Sequence  LTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRI
Query Conservation 
  





 


 






                
    


   

  


 


 



 

  

 




Alig confidence 




















.................................






















Template Conservation 




 
  
 
  



 

................................. 

  



 


 


  
  
Template Sequence  IKTAIALVRDXGGNSLKYFPX. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KGLAHEEEYRAVAKACAEEGFAL
Template Known Secondary structure  T




.................................TTTTTT
Template Predicted Secondary structure 





.................................






Template SS confidence 












































































   146...150.........160...... ...170.........180.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions