Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence66.06%DateThu Jan 5 11:42:17 GMT 2012
Rank349Aligned Residues48
% Identity23%Templatec3lpgA_
PDB info PDB header:hydrolase/hydrolase inhibitorChain: A: PDB Molecule:beta-glucuronidase; PDBTitle: structure of e. coli beta-glucuronidase bound with a novel, potent2 inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,3 2-dihydroquinolin-3-yl)methyl)urea
Resolution2.42 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   227..230.........240.........250.........260.........270.........280.........290.........300......
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  DLRGLTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIR
Query Conservation 

 

  





 


 






                
    


   

  


 


 



 

  

 



Alig confidence 





















........................





...............












Template Conservation          
   
  
 
 

 ........................      ...............    
 


 


Template Sequence  DNVLXVHDHALXDWIGANSYRT. . . . . . . . . . . . . . . . . . . . . . . . SHYPYA. . . . . . . . . . . . . . . EEXLDWADEHGIV
Template Known Secondary structure 
T


........................TTS


...............T
Template Predicted Secondary structure 




........................





...............


Template SS confidence 















































































   307..310.........320........ .330.... .....340.......
 
   307..310...
Predicted Secondary structure 

Query SS confidence 






Query Sequence  ILFDVVM
Query Conservation 



 
 
Alig confidence 






Template Conservation 
  
   
Template Sequence  VIDETAA
Template Known Secondary structure 
S
Template Predicted Secondary structure 


Template SS confidence 






   348.350....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions