Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence53.34%DateThu Jan 5 11:42:17 GMT 2012
Rank428Aligned Residues50
% Identity30%Templatec3hv9A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:protein fimx; PDBTitle: crystal structure of fimx eal domain from pseudomonas aeruginosa
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   235....240.........250.........260.........270.........280.........290.........300.........310..
Predicted Secondary structure 
















































Query SS confidence 













































































Query Sequence  LDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDVV
Query Conservation 




 


 






                
    


   

  


 


 



 

  

 







 
Alig confidence 















............................

































Template Conservation 
  
  
    



 ............................              
  

  
    
 


 

Template Sequence  FNALKHLTVQFIKIDG. . . . . . . . . . . . . . . . . . . . . . . . . . . . SFVQDLNQVENQEILKGLIAELHEQQKLSIVPFV
Template Known Secondary structure 


S
G............................GGGSSTTSTT



Template Predicted Secondary structure 



............................







Template SS confidence 













































































   604.....610......... 620.........630.........640.........650...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions