Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence51.96%DateThu Jan 5 11:42:17 GMT 2012
Rank433Aligned Residues48
% Identity19%Templatec3gndC_
PDB info PDB header:lyaseChain: C: PDB Molecule:aldolase lsrf; PDBTitle: crystal structure of e. coli lsrf in complex with ribulose-5-phosphate
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   240.........250.........260.........270.........280.........290.........300.........310......
Predicted Secondary structure 




















































Query SS confidence 












































































Query Sequence  QLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDVVMNHT
Query Conservation   


 






                
    


   

  


 


 



 

  

 







 
 


Alig confidence 









.....................










........


























Template Conservation 
 




 
 .....................   
   
   ........
     
   
   




 
     
Template Sequence  RLNSCAVAAQ. . . . . . . . . . . . . . . . . . . . . VYIGSEYEHQS. . . . . . . . IKNIIQLVDAGMKVGMPTMAVTGVVRD
Template Known Secondary structure  TT
S.....................
TTSTT........T






Template Predicted Secondary structure 



.....................





........







Template SS confidence 












































































   132.......140. ........150.. .......160.........170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions