Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence81.72%DateThu Jan 5 11:42:17 GMT 2012
Rank265Aligned Residues51
% Identity20%Templatec3cqkB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:l-ribulose-5-phosphate 3-epimerase ulae; PDBTitle: crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b)2 complex with zn2+ and sulfate
Resolution2.33 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   231........240.........250.........260.........270.........280.........290.........300.......
Predicted Secondary structure 















































Query SS confidence 












































































Query Sequence  LTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRI
Query Conservation 
  





 


 






                
    


   

  


 


 



 

  

 




Alig confidence 




















..........................





























Template Conservation    
 
  
   
   


   ..........................                          

 
Template Sequence  WLERLQLAKTLGFDFVEMSVD. . . . . . . . . . . . . . . . . . . . . . . . . . ETDERLSRLDWSREQRLALVNAIVETGVRV
Template Known Secondary structure  TT
S

..........................SSGGGG



B
Template Predicted Secondary structure 





..........................














Template SS confidence 












































































   21........30.........40. ........50.........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions