Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence95.75%DateThu Jan 5 11:42:17 GMT 2012
Rank157Aligned Residues54
% Identity15%Templatec2y8kA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:carbohydrate binding family 6; PDBTitle: structure of ctgh5-cbm6, an arabinoxylan-specific xylanase.
Resolution1.47 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   235....240.........250.........260.........270.........280........ .290.........300.........310.
Predicted Secondary structure 











































..



Query SS confidence 





















































. .






















Query Sequence  LDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMG. . NEADLRTLVDSAHQRGIRILFDV
Query Conservation 




 


 






                
    


   

  


 

..
 



 

  

 







 
Alig confidence 













.

......................














..






















Template Conservation         
 
 


.  ......................          
          

 

  
   






 
Template Sequence  IARVKELGFNAVHL. YA. . . . . . . . . . . . . . . . . . . . . . ECFDPRYPAPGSKAPGYAVNEIDKIVERTRELGLYLVITI
Template Known Secondary structure  GGGGGGT

.......................

TTTTSTT


TTTTT
Template Predicted Secondary structure 



.......................
















Template SS confidence 














































































   78.80.........90. .. ......100.........110.........120.........130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions