Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence54.08%DateThu Jan 5 11:42:17 GMT 2012
Rank423Aligned Residues51
% Identity24%Templatec2r6oB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:putative diguanylate cyclase/phosphodiesterase (ggdef & eal PDBTitle: crystal structure of putative diguanylate cyclase/phosphodiesterase2 from thiobacillus denitrificans
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   235....240.........250.........260.........270.........280.........290.........300.........310..
Predicted Secondary structure 
















































Query SS confidence 













































































Query Sequence  LDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDVV
Query Conservation 




 


 






                
    


   

  


 


 



 

  

 







 
Alig confidence 



















...........................






























Template Conservation     
     
 



   
 ...........................           
  
   
      


 

Template Sequence  LSYLSQLPFHGLKIDQSFVR. . . . . . . . . . . . . . . . . . . . . . . . . . . KIPAHPSETQIVTTILALARGLGXEVVAEGI
Template Known Secondary structure  S



T...........................TTTT
T



Template Predicted Secondary structure 




...........................








Template SS confidence 













































































   655....660.........670.... .....680.........690.........700.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions