Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence75.98%DateThu Jan 5 11:42:17 GMT 2012
Rank287Aligned Residues49
% Identity22%Templatec2qw5B_
PDB info PDB header:isomeraseChain: B: PDB Molecule:xylose isomerase-like tim barrel; PDBTitle: crystal structure of a putative sugar phosphate isomerase/epimerase2 (ava4194) from anabaena variabilis atcc 29413 at 1.78 a resolution
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   231........240.........250.........260.........270.........280.........290.........300.......
Predicted Secondary structure 















































Query SS confidence 












































































Query Sequence  LTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRI
Query Conservation 
  





 


 






                
    


   

  


 


 



 

  

 




Alig confidence 

















.




...........................

























Template Conservation 
   
  

  






.     ...........................          
  


  
   

 
Template Sequence  VVAHIKKLQRFGYSGFEF. PIAPG. . . . . . . . . . . . . . . . . . . . . . . . . . . LPENYAQDLENYTNLRHYLDSEGLEN
Template Known Secondary structure  TT

.



...........................
GGGTTTTT
Template Predicted Secondary structure 



.



...........................










Template SS confidence 












































































   32.......40......... 50.... .....60.........70.........80
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions