Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence91.09%DateThu Jan 5 11:42:17 GMT 2012
Rank201Aligned Residues51
% Identity22%Templatec2j75A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-glucosidase a; PDBTitle: beta-glucosidase from thermotoga maritima in complex with2 noeuromycin
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   232.......240.........250.........260.........270.........280......... 290.........300....
Predicted Secondary structure 












































.......

Query SS confidence 

























































. . . . . . .














Query Sequence  TNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGN. . . . . . . EADLRTLVDSAHQRG
Query Conservation    





 


 






                
    


   

  


 


....... 



 

  

 

Alig confidence 

















............................








.

.......














Template Conservation   


 
   

   



............................
 



 
 .
 
  
  

  
   

 
   
Template Sequence  KEDIEIIEKLGVKAYRFS. . . . . . . . . . . . . . . . . . . . . . . . . . . . ISWPRILPE. GTGRVNQKGLDFYNRIIDTLLEKG
Template Known Secondary structure  TT

............................

STT.SSS


TT
Template Predicted Secondary structure 




............................






.







Template SS confidence 















































































   62.......70......... 80........ .90.........100.........110..
 
   305....310.
Predicted Secondary structure 
Query SS confidence 






Query Sequence  IRILFDV
Query Conservation 





 
Alig confidence 






Template Conservation 
 




Template Sequence  ITPFVTI
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 






   113......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions