Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence56.57%DateThu Jan 5 11:42:17 GMT 2012
Rank404Aligned Residues41
% Identity12%Templatec2h6rG_
PDB info PDB header:isomeraseChain: G: PDB Molecule:triosephosphate isomerase; PDBTitle: crystal structure of triosephosphate isomerase (tim) from2 methanocaldococcus jannaschii
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   238.240.........250.........260.........270.........280.........290.........300.........310.
Predicted Secondary structure 















































Query SS confidence 









































































Query Sequence  LQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDV
Query Conservation 

 


 






                
    


   

  


 


 



 

  

 







 
Alig confidence 













.................................


























Template Conservation 
   
   





.................................


    
    
  
   

  



Template Sequence  IKDCGCKGTLINHS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . EKRMLLADIEAVINKCKNLGLETIVCT
Template Known Secondary structure  T

SBT.................................TB


T
Template Predicted Secondary structure 





.................................


Template SS confidence 









































































   78.80.........90. ........100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions