Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence94.18%DateThu Jan 5 11:42:17 GMT 2012
Rank175Aligned Residues55
% Identity18%Templatec2cksB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:endoglucanase e-5; PDBTitle: x-ray crystal structure of the catalytic domain of2 thermobifida fusca endoglucanase cel5a (e5)
Resolution1.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   232....... 240.........250.........260.........270.........280.........290.........300.........310
Predicted Secondary structure  .















































Query SS confidence 







.






































































Query Sequence  TNKLDYLQ. QLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFD
Query Conservation    





. 


 






                
    


   

  


 


 



 

  

 







Alig confidence 







.








.......................













..






















Template Conservation        
 
  
 
 


.......................              ..  
  

  
  
   

 



Template Sequence  DSSLDALAYDWKADIIRL. . . . . . . . . . . . . . . . . . . . . . . SMYIQEDGYETNPR. . GFTDRMHQLIDMATARGLYVIVD
Template Known Secondary structure  TS

S.......................SSTTSGGG
..TTT
Template Predicted Secondary structure 



.......................









..


Template SS confidence 















































































   169170.........180...... ...190.........200 .........210.........220...
 
   311
Predicted Secondary structure 
Query SS confidence 
Query Sequence  V
Query Conservation   
Alig confidence 
Template Conservation   
Template Sequence  W
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   224
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions