Return to main results Retrieve Phyre Job Id

Job DescriptionP25718
Confidence50.82%DateThu Jan 5 11:42:17 GMT 2012
Rank440Aligned Residues43
% Identity21%Templatec1u83A_
PDB info PDB header:lyaseChain: A: PDB Molecule:phosphosulfolactate synthase; PDBTitle: psl synthase from bacillus subtilis
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   235....240.........250.........260.........270.........280.........290.........300.........310.
Predicted Secondary structure 















































Query SS confidence 












































































Query Sequence  LDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDV
Query Conservation 




 


 






                
    


   

  


 


 



 

  

 







 
Alig confidence 





















.................................










.









Template Conservation 
     


  





   
 .................................   
   
   .   
 
 


Template Sequence  HRYCTYFGCEYIEISNGTLPXT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NKEKAAYIADF. SDEFLVLSEV
Template Known Secondary structure  TT
S

SSS


..................................TTTS
Template Predicted Secondary structure 










..................................

Template SS confidence 












































































   94.....100.........110..... ....120...... ...130......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions