Return to main results Retrieve Phyre Job Id

Job DescriptionP36659
Confidence49.56%DateThu Jan 5 11:53:32 GMT 2012
Rank62Aligned Residues29
% Identity21%Templatec2q37A_
PDB info PDB header:plant protein, lyaseChain: A: PDB Molecule:ohcu decarboxylase; PDBTitle: crystal structure of ohcu decarboxylase in the presence of2 (s)-allantoin
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30......... 40.........50....
Predicted Secondary structure 






............
Query SS confidence 













. . . . . . . . . . . .














Query Sequence  RRLARKYHPDVSKE. . . . . . . . . . . . PDAEARFKEVAEAWE
Query Conservation 



 
 




  ............  
  


 
  


Alig confidence 













............














Template Conservation      
 


 

       


          
  

  
 
Template Sequence  WLEAFSAHPQIGNTPSEQSTAFATTSASALQELAEWNVLYK
Template Known Secondary structure  TS

TTS


TTTS

Template Predicted Secondary structure 










Template SS confidence 








































   51........60.........70.........80.........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions