Return to main results Retrieve Phyre Job Id

Job DescriptionP00722
Confidence36.38%DateThu Jan 5 10:56:50 GMT 2012
Rank223Aligned Residues48
% Identity10%Templatec2xt6B_
PDB info PDB header:lyaseChain: B: PDB Molecule:2-oxoglutarate decarboxylase; PDBTitle: crystal structure of mycobacterium smegmatis alpha-ketoglutarate2 decarboxylase homodimer (orthorhombic form)
Resolution2.74 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   391........400.........410.........420.........430.........440.........450......
Predicted Secondary structure 





























Query SS confidence 

































































Query Sequence  SHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVII
Query Conservation 



    






 

 
 


  
 

          
            

 








 
Alig confidence 




















..................


























Template Conservation 











    

 

.................. 





 







    






Template Sequence  HTSGRIERFLQLWAEGSMTIA. . . . . . . . . . . . . . . . . . MPSTPANYFHLLRRHGKDGIQRPLIVF
Template Known Secondary structure  SS




TTS
..................

SSSS



Template Predicted Secondary structure 








..................








Template SS confidence 

































































   1020.........1030.........1040 .........1050.........1060.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions