Return to main results Retrieve Phyre Job Id

Job DescriptionP64550
Confidence7.91%DateThu Jan 5 12:09:22 GMT 2012
Rank25Aligned Residues43
% Identity19%Templatec3a7kD_
PDB info PDB header:membrane proteinChain: D: PDB Molecule:halorhodopsin; PDBTitle: crystal structure of halorhodopsin from natronomonas2 pharaonis
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70.........80.........90.........100.........110.........120.....
Predicted Secondary structure 






Query SS confidence 


































































Query Sequence  YGMYRDLFMRAARKVSPSGWIKNLADILAYVTFQSPVYVAILLVVGADWHQIMAAVSSNIVVSMLMG
Query Conservation 

  

   
 

      
   
 
 

 



 






   

     
 

 

 



  
Alig confidence 








......................






.














.











Template Conservation    




 
......................





 . 
 



     
  .

 
  



 
Template Sequence  WGRYLTWAL. . . . . . . . . . . . . . . . . . . . . . STPMILL. ALGLLAGSNATKLFT. AITFDIAMCVTG
Template Known Secondary structure  T.......................TT

.
Template Predicted Secondary structure  .......................



.
Template SS confidence 


































































   121........ 130...... ...140.........150. ........160...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions