Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB01
Confidence24.48%DateThu Jan 5 11:14:15 GMT 2012
Rank152Aligned Residues27
% Identity26%Templatec3cpiH_
PDB info PDB header:protein transportChain: H: PDB Molecule:rab gdp-dissociation inhibitor; PDBTitle: crystal structure of yeast rab-gdi
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82.......90.........100.........110.........120.....
Predicted Secondary structure 




















Query SS confidence 











































Query Sequence  IVVLGGGYTWNPQWAPSSNLINNSLPRLNEGIRLWRENPGSKLI
Query Conservation 






                   

  
  
        

Alig confidence 







.................


















Template Conservation 






 ................. 

  
  

  
  



Template Sequence  VIVLGTGI. . . . . . . . . . . . . . . . . TECILSGLLSVDGKKVLHI
Template Known Secondary structure 

S.................TT

Template Predicted Secondary structure 


.................


Template SS confidence 











































   12....... 20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions