Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB01
Confidence21.61%DateThu Jan 5 11:14:15 GMT 2012
Rank174Aligned Residues60
% Identity20%Templatec2weuD_
PDB info PDB header:antifungal proteinChain: D: PDB Molecule:tryptophan 5-halogenase; PDBTitle: crystal structure of tryptophan 5-halogenase (pyrh) complex2 with substrate tryptophan
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82.......90.........100.........110........ .120.........130.........140.........150........
Predicted Secondary structure 
















...

















Query SS confidence 




































. . .







































Query Sequence  IVVLGGGYTWNPQWAPSSNLINNSLPRLNEGIRLWRE. . . NPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGVPREQIIT
Query Conservation 






                   

  
  
   ...     

 


       


  
   
   


   
  
Alig confidence 







.................











...









.....
























Template Conservation 






 .................

  

  


    
  




 
.....


 
 
     
  


 
     
Template Sequence  VVIVGGGT. . . . . . . . . . . . . . . . . AGWMTASYLKAAFDDRIDVTLVESG. . . . . VGEATFSTVRHFFDYLGLDEREWLP
Template Known Secondary structure 

.................GGGS

.....



TTT

TT
Template Predicted Secondary structure 

.................





.....










Template SS confidence 















































































   5....10.. .......20.........30....... ..40.........50.........60..
 
   159160...
Predicted Secondary structure 



Query SS confidence 




Query Sequence  LDLPK
Query Conservation 
  
 
Alig confidence 




Template Conservation     

Template Sequence  RCAGG
Template Known Secondary structure  TTT
Template Predicted Secondary structure 


Template SS confidence 




   6970...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions