Return to main results Retrieve Phyre Job Id

Job DescriptionP13024
Confidence22.95%DateThu Jan 5 11:33:27 GMT 2012
Rank297Aligned Residues26
% Identity27%Templatec3kqiA_
PDB info PDB header:nuclear proteinChain: A: PDB Molecule:phd finger protein 2; PDBTitle: crystal structure of phf2 phd domain complexed with h3k4me3 peptide
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200.........210.........220....
Predicted Secondary structure 
























Query SS confidence 



































Query Sequence  YCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEWHV
Query Conservation   





 
  
 
      
 
 
 

 
 
 
  
Alig confidence 

.



.........



















Template Conservation   
.

  .........       

 

 
  
 
 
Template Sequence  YC. VCRL. . . . . . . . . PYDVTRFMIECDACKDWFHG
Template Known Secondary structure  T.TTT.........

TTS

TTT

Template Predicted Secondary structure  .


.........











Template SS confidence 



































   7. .10.. .......20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions