Return to main results Retrieve Phyre Job Id

Job DescriptionP13024
Confidence60.92%DateThu Jan 5 11:33:27 GMT 2012
Rank89Aligned Residues24
% Identity38%Templatec2gajA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:dna topoisomerase i; PDBTitle: structure of full length topoisomerase i from thermotoga maritima in2 monoclinic crystal form
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   190.........200.........210.........220
Predicted Secondary structure 



















Query SS confidence 






























Query Sequence  CPVCGSMPVSSMVQIGTTQGLRYLHCNLCET
Query Conservation 





 
  
 
      
 
 
 

 
 
Alig confidence 

.



....








.





.


Template Conservation 

.

  ....
     
 
. 
  
 .
  
Template Sequence  CS. CGKE. . . . MRLSFGKYG. FYLKCE. CGK
Template Known Secondary structure 
S.SS
....TT.
S.SS
Template Predicted Secondary structure 

.



....



.
.


Template SS confidence 






























   559560 .... .....570... ...... 580..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions