Return to main results Retrieve Phyre Job Id

Job DescriptionP76085
Confidence5.98%DateThu Jan 5 12:18:37 GMT 2012
Rank80Aligned Residues48
% Identity15%Templatec1pk1B_
PDB info PDB header:transcription repressionChain: B: PDB Molecule:sex comb on midleg cg9495-pa; PDBTitle: hetero sam domain structure of ph and scm.
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

















Query SS confidence 

































































Query Sequence  DPIETASVDELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDLRKFPCTTKQDLRD
Query Conservation                
   
   
  
    
 
          
  
    

  

 
 
  
  
Alig confidence 



.








........




















.........













Template Conservation   
  .

  

  
........
         
   
    

.........
  

 

  

  
Template Sequence  QPID. WTIEEVIQY. . . . . . . . IESNDNSLAVHGDLFRKHEID. . . . . . . . . GKALLRLNSERMMK
Template Known Secondary structure 
GGG.

........
GGGGGGTT

.........T

Template Predicted Secondary structure 



.

........







.........


Template SS confidence 

































































   13... ...20..... ....30.........40...... ...50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions