Return to main results Retrieve Phyre Job Id

Job DescriptionP29131
Confidence21.14%DateThu Jan 5 11:45:35 GMT 2012
Rank65Aligned Residues45
% Identity18%Templatec2q5cA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:ntrc family transcriptional regulator; PDBTitle: crystal structure of ntrc family transcriptional regulator from2 clostridium acetobutylicum
Resolution1.49 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   254.....260.........270.........280.........290.........300.........310......
Predicted Secondary structure 




















Query SS confidence 






























































Query Sequence  SFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLA
Query Conservation 

     
      
   
  
 
       

 


  
   
      

  
        
Alig confidence 




















...........













.......









Template Conservation        
    
      
  ...........



       
  ....... 

  


 
Template Sequence  LFSSEDEITTLISKVKTENIK. . . . . . . . . . . IVVSGKTVTDEAIK. . . . . . . QGLYGETINS
Template Known Secondary structure 
SGGGTT

...........
.......TT



Template Predicted Secondary structure 




...........
.......




Template SS confidence 






























































   122.......130.........140.. .......150...... ...160......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions