Return to main results Retrieve Phyre Job Id

Job DescriptionP0AES0
Confidence36.79%DateThu Jan 5 11:24:04 GMT 2012
Rank91Aligned Residues56
% Identity18%Templatec2xivA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:hypothetical invasion protein; PDBTitle: structure of rv1477, hypothetical invasion protein of2 mycobacterium tuberculosis
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70.........80.........90.........100.........110.........120.........130.......
Predicted Secondary structure 



































Query SS confidence 














































































Query Sequence  CVEFARRFLFLNYGVVFTDVGMAWEIFSLRFLREVVNDNILPLQAFPNGSPRAPVAGALLIWDKGGEFKDTGHVAIITQ
Query Conservation 






 
    
  
  
  
  
  
            

    

    
  




        
 





  
Alig confidence 




.











..
















................













....







Template Conservation 


 
.  
    

 

..
 
  
   
  
    ................  





      .... 




 
Template Sequence  CSGLV. LYSFAGVGIKLP. . HYSGSQYNLGRKIPSSQ. . . . . . . . . . . . . . . . XRRGDVIFYGPNGS. . . . QHVTIYLG
Template Known Secondary structure  .TTT



..BSTTSSGGG................

TT
SGGG
....S
Template Predicted Secondary structure  .





..








................









....
Template SS confidence 














































































   383.... ..390......... 400.........410...... ...420.........430 ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions