Return to main results Retrieve Phyre Job Id

Job DescriptionQ46803
Confidence85.31%DateThu Jan 5 12:34:30 GMT 2012
Rank196Aligned Residues55
% Identity18%Templatec2zxrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:single-stranded dna specific exonuclease recj; PDBTitle: crystal structure of recj in complex with mg2+ from thermus2 thermophilus hb8
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   187..190.........200.........210.........220.........230.........240.........250.........260......
Predicted Secondary structure 































Query SS confidence 















































































Query Sequence  KGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVTLAHPEGYDLIPDVVEVAKNNAKASGGSFRQVTSMEEAFKDADI
Query Conservation   
 


 
       
   


 

       
  
 
  
        
   
       
  
  
 
  


  


Alig confidence 











...

























.....................








.....



Template Conservation    


 
 



...









   
  


 
  


..................... 






 .....



Template Sequence  QGKRIRVHGDYD. . . ADGLTGTAILVRGLAALGADVHPFIP. . . . . . . . . . . . . . . . . . . . . SDLFLTVDC. . . . . GVEV
Template Known Secondary structure  TT


SS...TT



.....................

S

.....

Template Predicted Secondary structure 





...





.....................


.....


Template SS confidence 















































































   71........80.. .......90.........100........ .110....... ..120.
 
   267..270
Predicted Secondary structure 

Query SS confidence 



Query Sequence  VYPK
Query Conservation 



Alig confidence 



Template Conservation 



Template Sequence  IVTD
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   156...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions