Return to main results Retrieve Phyre Job Id

Job DescriptionQ46803
Confidence20.24%DateThu Jan 5 12:34:30 GMT 2012
Rank433Aligned Residues25
% Identity24%Templatec1khdD_
PDB info PDB header:transferaseChain: D: PDB Molecule:anthranilate phosphoribosyltransferase; PDBTitle: crystal structure analysis of the anthranilate2 phosphoribosyltransferase from erwinia carotovora at 1.93 resolution (current name, pectobacterium carotovorum)
Resolution1.86 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40
Predicted Secondary structure 








Query SS confidence 




































Query Sequence  TVNELIKDINSLTSHLHEKDFLLTWEQTPDELKQVLD
Query Conservation             
   
  



   
 
  

  

 
Alig confidence 








............















Template Conservation 

   
 
 ............  
  

 


     
Template Sequence  THQPILEKL. . . . . . . . . . . . FKSQSMTQEESHQLFA
Template Known Secondary structure 

............TT



Template Predicted Secondary structure 
............





Template SS confidence 




































   12.......20 .........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions