Return to main results Retrieve Phyre Job Id

Job DescriptionP76194
Confidence22.00%DateThu Jan 5 12:20:21 GMT 2012
Rank35Aligned Residues35
% Identity17%Templatec3n00A_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:rev-erba-alpha; PDBTitle: crystal structure of a deletion mutant of human reverba ligand binding2 domain bound with an ncor id1 peptide determined to 2.60a
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10. ........20... ......30.........
Predicted Secondary structure  .............



.




Query SS confidence 






. . . . . . . . . . . . .











.















Query Sequence  PDKEKLL. . . . . . . . . . . . . RNFLRCANWEEK. YLYIIELGQRLPELRD
Query Conservation       

.............
 
    


 
.
  

 


 

 


Alig confidence 






.............











.















Template Conservation        
                          
   
 


 

 
  
Template Sequence  PTVEDVISQVARAHREIFVQEIWEDFSMSFTPAVREVVEFAKHIPGFRD
Template Known Secondary structure 




STTGGG
Template Predicted Secondary structure 










Template SS confidence 
















































   283......290.........300.........310.........320.........330.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions