Return to main results Retrieve Phyre Job Id

Job DescriptionP77129
Confidence3.70%DateThu Jan 5 12:25:34 GMT 2012
Rank89Aligned Residues29
% Identity14%Templatec3fefB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:putative glucosidase lpld; PDBTitle: crystal structure of putative glucosidase lpld from2 bacillus subtilis
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   306...310.........320.........330.........340....
Predicted Secondary structure 




Query SS confidence 






































Query Sequence  ETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEMAEIY
Query Conservation 

 



 
 
 



   

 
  
 
      
  

Alig confidence 











..........
















Template Conservation 

 
 

   

..........





 

   
    
Template Sequence  DTVGPGGIIRGL. . . . . . . . . . RAVPIFAEIARAIRDYA
Template Known Secondary structure  SSS..........
Template Predicted Secondary structure 




..........
Template SS confidence 






































   113......120.... .....130.........140.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions