Return to main results Retrieve Phyre Job Id

Job DescriptionP33195
Confidence22.07%DateThu Jan 5 11:51:15 GMT 2012
Rank379Aligned Residues28
% Identity29%Templatec2wmhA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:fucolectin-related protein; PDBTitle: crystal structure of the catalytic module of a family 982 glycoside hydrolase from streptococcus pneumoniae tigr4 in3 complex with the h-disaccharide blood group antigen.
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   653......660 .........670.........680
Predicted Secondary structure 





............



Query SS confidence 







. . . . . . . . . . . .



















Query Sequence  YPSTHGVY. . . . . . . . . . . . EETIREVCEVVHQFGGQVYL
Query Conservation   


 


............
  
 

 



  





Alig confidence 







............



















Template Conservation 



 
    



       

 
 



  





  
Template Sequence  YSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIW
Template Known Secondary structure 
TT

TTS

TTTT
Template Predicted Secondary structure 

















Template SS confidence 







































   148.150.........160.........170.........180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions