Return to main results Retrieve Phyre Job Id

Job DescriptionP75906
Confidence26.26%DateThu Jan 5 12:15:53 GMT 2012
Rank337Aligned Residues32
% Identity19%Templatec3nzkB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:udp-3-o-[3-hydroxymyristoyl] n-acetylglucosamine PDBTitle: structure of lpxc from yersinia enterocolitica complexed with chir0902 inhibitor
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   74.....80.........90.........100.........110.........
Predicted Secondary structure 


















Query SS confidence 













































Query Sequence  LREQFAWLRENGYQPVSIAQIREAHRGGKPLPEKAVVLTFDDGYQS
Query Conservation 

 

  

  

  


 

      
  

 










 
Alig confidence 











............






.






.





Template Conservation     


 
   
............

 



. 



  .    

Template Sequence  FMRDIEYLQSRG. . . . . . . . . . . . LCLGGSF. DCAIVVD. DYRVLN
Template Known Secondary structure  TTT............

TT

T.TT

.SSSB

Template Predicted Secondary structure 

............






.

.


Template SS confidence 













































   194.....200..... ....210.. ....... 220.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions