Return to main results Retrieve Phyre Job Id

Job DescriptionP75906
Confidence56.73%DateThu Jan 5 12:15:53 GMT 2012
Rank259Aligned Residues58
% Identity10%Templatec3fxtB_
PDB info PDB header:gene regulationChain: B: PDB Molecule:nucleoside diphosphate-linked moiety x motif 6; PDBTitle: crystal structure of the n-terminal domain of human nudt6
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   317..320....... ..330.........340.........350.........360.........370.........380.........390...
Predicted Secondary structure 




...


























Query SS confidence 










. . .

































































Query Sequence  MHIDLDYVYDE. . . NLQQMDRNIDVLIQRVKDMQISTVYLQAFADPDGDGLVKEVWFPNRLLPMKADIFSRVAWQLRTRS
Query Conservation      

  

 ...

 

   
  



      


 

    
 

      


    
   
     
 

  
 
Alig confidence 










...



























........................













Template Conservation 
 
           
   
   
  

  
       




........................
     

  
   
Template Sequence  ISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHI. . . . . . . . . . . . . . . . . . . . . . . . PILQSRFIAPAASL
Template Known Secondary structure  TTTS


TT

........................GGGGGGTT
Template Predicted Secondary structure 










........................

Template SS confidence 















































































   56...60.........70.........80.........90....... ..100.........110.
 
   394....
Predicted Secondary structure 

Query SS confidence 




Query Sequence  GVNIY
Query Conservation 
  
 
Alig confidence 




Template Conservation 

 

Template Sequence  GFCFH
Template Known Secondary structure  T
Template Predicted Secondary structure 

Template SS confidence 




   112....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions