Return to main results Retrieve Phyre Job Id

Job DescriptionP75906
Confidence34.48%DateThu Jan 5 12:15:53 GMT 2012
Rank299Aligned Residues54
% Identity22%Templatec3fhaD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:endo-beta-n-acetylglucosaminidase; PDBTitle: structure of endo-beta-n-acetylglucosaminidase a
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   389390.........400.........410.........420.........430.........440.........450.........460....
Predicted Secondary structure 









































Query SS confidence 











































































Query Sequence  LRTRSGVNIYAWMPVLSWDLDPTLTRVKYLPTGEKKAQIHPEQYHRLSPFDDRVRAQVGMLYEDLAGHAAFDGILF
Query Conservation 
  
 
  
 

                                  
 
  
 

  
  
  

   
 



 
Alig confidence 


































......................


















Template Conservation 






 




  
                   ...................... 
 


 

  







Template Sequence  ASHRNGVPILGNVFFPPTVYGGQLEWLEQMLEQEP. . . . . . . . . . . . . . . . . . . . . . LADKLLEVADYYGFDGWFI
Template Known Secondary structure  TT



GGGT

T



......................T

Template Predicted Secondary structure 












......................


Template SS confidence 











































































   112.......120.........130.........140...... ...150.........160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions