Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFE4
Confidence0.76%DateThu Jan 5 11:26:02 GMT 2012
Rank100Aligned Residues23
% Identity22%Templatec2rgiA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:protein s100-a2; PDBTitle: crystal structure of ca2+-free s100a2 at 1.6 a resolution
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80....... ..90........
Predicted Secondary structure  .......




Query SS confidence 











. . . . . . .










Query Sequence  GLALLLQLHRRR. . . . . . . QNLNIDSVSEM
Query Conservation   


 
  

  .......

 
 
    
Alig confidence 











.......










Template Conservation   
  
  

  
   

  
 

  

  
Template Sequence  ALAVLVTTFHKYSSQEGDKFKLSKGEMKEL
Template Known Secondary structure  TTSS
TT
Template Predicted Secondary structure 









Template SS confidence 





























   8.10.........20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions