Return to main results Retrieve Phyre Job Id

Job DescriptionP07102
Confidence4.29%DateThu Jan 5 11:00:08 GMT 2012
Rank74Aligned Residues33
% Identity30%Templatec3no4A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:creatinine amidohydrolase; PDBTitle: crystal structure of a creatinine amidohydrolase (npun_f1913) from2 nostoc punctiforme pcc 73102 at 2.00 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   293......300.........310.........320.........330.....
Predicted Secondary structure 















Query SS confidence 










































Query Sequence  LLDLIKTALTPHPPQKQAYGVTLPTSVLFIAGHDTNLANLGGA
Query Conservation 

  
   
                
  








  

 
Alig confidence 













..........


















Template Conservation   
 

  

   

..........
 









       
Template Sequence  VVRDYVTCLAKAGF. . . . . . . . . . SKFYFINGHGGNIATLKAA
Template Known Secondary structure  T
..........


TT
Template Predicted Secondary structure 


..........





Template SS confidence 










































   88.90.........100. ........110.........120
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions