Return to main results Retrieve Phyre Job Id

Job DescriptionP32129
Confidence3.00%DateThu Jan 5 11:49:14 GMT 2012
Rank86Aligned Residues36
% Identity22%Templatec2a4aB_
PDB info PDB header:lyaseChain: B: PDB Molecule:deoxyribose-phosphate aldolase; PDBTitle: deoxyribose-phosphate aldolase from p. yoelii
Resolution1.84 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210.........220.........230....
Predicted Secondary structure 
























Query SS confidence 


















































Query Sequence  TIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAGIAMALNVLGKQFDKLLNV
Query Conservation   
 






               

 

 


             
 

Alig confidence 
















...............


















Template Conservation 





 
      
  ...............
   

  

 


 


 
Template Sequence  CVINFPYGTDSMEKVLN. . . . . . . . . . . . . . . DTEKALDDGADEIDLVINY
Template Known Secondary structure  STTT

S
...............T
S

Template Predicted Secondary structure 







...............





Template SS confidence 


















































   75....80.........90. ........100.........110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions