Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEE3
Confidence94.29%DateThu Jan 5 11:23:07 GMT 2012
Rank366Aligned Residues31
% Identity26%Templatec1eptA_
PDB info PDB header:hydrolase (serine protease)Chain: A: PDB Molecule:porcine e-trypsin; PDBTitle: refined 1.8 angstroms resolution crystal structure of2 porcine epsilon-trypsin
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70.........80.........90.........
Predicted Secondary structure 


















Query SS confidence 











































Query Sequence  PAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVIN
Query Conservation   


 
                  


 

   
 


  


 
Alig confidence 






............













.









Template Conservation 

 
 
 ............     





   . 







 
Template Sequence  PYQVSLN. . . . . . . . . . . . SGSHFCGGSLINSQ. WVVSAAHCYK
Template Known Secondary structure  TT............SSSTT.

GGG

Template Predicted Secondary structure 

............






.

Template SS confidence 











































   28.30.... .....40........ .50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions