Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMR6
Confidence14.33%DateThu Jan 5 12:37:50 GMT 2012
Rank64Aligned Residues31
% Identity35%Templated2cpqa1
SCOP infoEukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   236...240.........250.........260.........270.....
Predicted Secondary structure 


















Query SS confidence 







































Query Sequence  LGYFAGKLGRGKVLVLRKGDIEIPSDLAGVLYTELDEHGG
Query Conservation 

 






 

 

    






 

 
   
    
Alig confidence 










.........



















Template Conservation 





  


.........

 

 



  
 


 
 
Template Sequence  MGLAIGTHGSN. . . . . . . . . IQQARKVPGVTAIELDEDTG
Template Known Secondary structure  TTTT.........TSTTTTTT
Template Predicted Secondary structure 



.........








Template SS confidence 







































   230.........240 .........250.........260
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions