Return to main results Retrieve Phyre Job Id

Job DescriptionP24232
Confidence22.71%DateThu Jan 5 11:41:28 GMT 2012
Rank252Aligned Residues27
% Identity15%Templatec3iwdC_
PDB info PDB header:lyaseChain: C: PDB Molecule:s-adenosylmethionine decarboxylase; PDBTitle: t. maritima adometdc complex with 5'-deoxy-5'-dimethyl2 thioadenosine
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   358.360.........370.........380.........390.....
Predicted Secondary structure 













Query SS confidence 





































Query Sequence  QFYLCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKV
Query Conservation   
 



  
   
   
   

    
  
 


   
Alig confidence 




















...........





Template Conservation 





    
  
   
   ...........
    
Template Sequence  DLFTCGEDVDPWKAFEHLKKA. . . . . . . . . . . LKAKRV
Template Known Secondary structure 


STT

...........TT
S

Template Predicted Secondary structure 





...........



Template SS confidence 





































   7980.........90......... 100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions