Return to main results Retrieve Phyre Job Id

Job DescriptionP31658
Confidence28.02%DateThu Jan 5 11:48:23 GMT 2012
Rank164Aligned Residues33
% Identity12%Templatec3qjgD_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:epidermin biosynthesis protein epid; PDBTitle: epidermin biosynthesis protein epid from staphylococcus aureus
Resolution2.04 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60.........70.........80.........90.....
Predicted Secondary structure 


















Query SS confidence 














































Query Sequence  HKILVIAADERYLPTDNGKLFSTGNHPIETLLPLYHLHAAGFEFEVA
Query Conservation   




 
    
 
  
    

    

  
   
  

 




Alig confidence 









...........









...












Template Conservation 
 


 



...........        

...  
   
  
 

Template Sequence  ENVLICLCGS. . . . . . . . . . . VNSINISHYI. . . IELKSKFDEVNVI
Template Known Secondary structure 

SS...........GGGGG...TTT
S
Template Predicted Secondary structure 

..............


Template SS confidence 














































   3......10.. .......20.. .......30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions