Return to main results Retrieve Phyre Job Id

Job DescriptionP31658
Confidence52.60%DateThu Jan 5 11:48:23 GMT 2012
Rank118Aligned Residues36
% Identity31%Templatec3othB_
PDB info PDB header:transferase/antibioticChain: B: PDB Molecule:calg1; PDBTitle: crystal structure of calg1, calicheamicin glycostyltransferase, tdp2 and calicheamicin alpha3i bound form
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60.........70.........80.........90.......
Predicted Secondary structure 




















Query SS confidence 
















































Query Sequence  HKILVIAADERYLPTDNGKLFSTGNHPIETLLPLYHLHAAGFEFEVATI
Query Conservation   




 
    
 
  
    

    

  
   
  

 






Alig confidence 









.............

























Template Conservation   


      ............. 

      

  
  




 
 
 
Template Sequence  XRVLFASLGT. . . . . . . . . . . . . HGHTYPLLPLATAARAAGHEVTFATG
Template Known Secondary structure 


SS.............GGGTT

Template Predicted Secondary structure 




.............




Template SS confidence 
















































   1........10 .........20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions