Return to main results Retrieve Phyre Job Id

Job DescriptionP31658
Confidence67.94%DateThu Jan 5 11:48:23 GMT 2012
Rank100Aligned Residues38
% Identity21%Templatec2iyaB_
PDB info PDB header:transferaseChain: B: PDB Molecule:oleandomycin glycosyltransferase; PDBTitle: the crystal structure of macrolide glycosyltransferases: a2 blueprint for antibiotic engineering
Resolution1.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90.......
Predicted Secondary structure 






















Query SS confidence 


















































Query Sequence  GKHKILVIAADERYLPTDNGKLFSTGNHPIETLLPLYHLHAAGFEFEVATI
Query Conservation   
 




 
    
 
  
    

    

  
   
  

 






Alig confidence 








.............




























Template Conservation   
 


   .............    

    
 

  
  


 
 
 
 
Template Sequence  TPRHISFFN. . . . . . . . . . . . . IPGHGHVNPSLGIVQELVARGHRVSYAIT
Template Known Secondary structure 



.............
S
TT

Template Predicted Secondary structure 



.............







Template SS confidence 


















































   11........ 20.........30.........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions