Return to main results Retrieve Phyre Job Id

Job DescriptionQ46795
Confidence1.68%DateThu Jan 5 12:34:15 GMT 2012
Rank70Aligned Residues34
% Identity15%Templatec3crqA_
PDB info PDB header:transferaseChain: A: PDB Molecule:trna delta(2)-isopentenylpyrophosphate PDBTitle: structure of trna dimethylallyltransferase: rna2 modification through a channel
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   65....70.........80.........90.........100.........110.......
Predicted Secondary structure 













Query SS confidence 




















































Query Sequence  TCGFSTLLPYIRQQPLAMQQRFNLLFPDFVDHIQSPLPLASTLLERITFYAKK
Query Conservation    
   

  
  

 

 


 



   
     

   






 


 
Alig confidence 












...................




















Template Conservation 



 
   

 
...................     
        

 



Template Sequence  AVGYRQVWDYLDG. . . . . . . . . . . . . . . . . . . KLSYAEMTERGIIATRQLAKR
Template Known Secondary structure  STTTT...................SS
Template Predicted Secondary structure 



...................


Template SS confidence 




















































   254.....260...... ...270.........280.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions